HORDB

ID: hor005970
Uniprot ID: P27682(198-210)
Protein name: C-terminal peptide
Gene name: Scg5
Organism: Rattus norvegicus (Rat)
Family: 7B2 family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0004857 enzyme inhibitor activity; GO:0005515 protein binding; GO:0030234 enzyme regulator activity; GO:0051082 unfolded protein binding
GO BP: GO:0006886 intracellular protein transport; GO:0007218 neuropeptide signaling pathway; GO:0016486 peptide hormone processing; GO:0046883 regulation of hormone secretion
GO CC: GO:0005576 extracellular region; GO:0005634 nucleus; GO:0030141 secretory granule

Sequence: SVPHFSEEEKEPE
Length: 13(198-210)
Propeptide: MTSRMAILSGLLFWLLLEWNPAFAYSPRTPDRVSETDIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPLGKTADDGCLENAPDTAEFSREFQLDQHLFDPEHDYPGLGKWNKKLLYEKMKGGQRRKRRSVNPYLQGKRLDNVVAKKSVPHFSEEEKEPE
Signal peptide: MTSRMAILSGLLFWLLLEWNPAFA
Modification: T6 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Function: Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathw
Mechanism: NA
Cross BBB: NA
Target: Pcsk2
Target Unid: P28841
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005970_AF2.pdb

hor005970_ESM.pdb

Mass:	175780	Formula:	C67H98N16O26
Absent amino acids:	ACDGILMNQRTWY	Common amino acids:	E
pI:	4.02	Basic residues:	2
Polar residues:	2	Hydrophobic residues:	2
Hydrophobicity:	-172.31	Boman Index:	-4404
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	22.31
Instability Index:	10922.31	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 1709861
Title: Cloning and characterization of the rat complementary deoxyribonucleic acid and gene encoding the neuroendocrine peptide 7B2.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 11439082
Title: Neuroendocrine sec
PubMed ID: 22673903
Title: